Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9BAEVK)

DOT Name Transmembrane protein 14B (TMEM14B)
Gene Name TMEM14B
UniProt ID
TM14B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF03647
Sequence
MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDP
RNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD
Function
Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions.
Tissue Specificity Mainly expressed in the outer subventricular zone (OSVZ) of the fetal brains.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Transmembrane protein 14B (TMEM14B). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transmembrane protein 14B (TMEM14B). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Transmembrane protein 14B (TMEM14B). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Transmembrane protein 14B (TMEM14B). [4]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Transmembrane protein 14B (TMEM14B). [5]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Transmembrane protein 14B (TMEM14B). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.