Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9EK367)

• DOT Name: Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2)
• Synonyms: PRPP synthase-associated protein 2; 41 kDa phosphoribosypyrophosphate synthetase-associated protein; PAP41
• Gene Name: PRPSAP2
• UniProt ID: KPRB_HUMAN
• PDB ID: 2JI4
• Pfam ID: PF14572 ; PF13793
• Sequence:
  MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETR
  VQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMR
  KRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDY
  RNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPS
  LEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHG
  LLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSY
  LFRNIGLDD
• Function: Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Phosphoribosyl pyrophosphate synthase-associated protein 2 (PRPSAP2).	[6]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [7] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.