Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9JFFO2)

• DOT Name: Phospholipase A and acyltransferase 5 (PLAAT5)
• Synonyms: Ca(2+)-independent N-acyltransferase; iNAT; EC 2.3.1.-, EC 3.1.1.32, EC 3.1.1.4; H-rev107-like protein 5; HRAS-like suppressor 5; HRSL5
• Gene Name: PLAAT5
• UniProt ID: PLAT5_HUMAN
• EC Number: 2.3.1.-; 3.1.1.32; 3.1.1.4
• Pfam ID: PF04970
• Sequence:
  MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELE
  ESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLI
  KQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVV
  KYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGL
  RYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA
• Function: Exhibits both phospholipase A1/2 and acyltransferase activities. Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids. Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs).
• Tissue Specificity: Highest expression level in testis and pancreas.
• Reactome Pathway: Acyl chain remodelling of PE (R-HSA-1482839)
• BioCyc Pathway: MetaCyc:ENSG00000168004-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Phospholipase A and acyltransferase 5 (PLAAT5).	[1]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Phospholipase A and acyltransferase 5 (PLAAT5).	[2]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Phospholipase A and acyltransferase 5 (PLAAT5).	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Phospholipase A and acyltransferase 5 (PLAAT5).	[3]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.