Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9WY5AH)

• DOT Name: Protein FAM136A (FAM136A)
• Gene Name: FAM136A
• Related Disease:
  Meniere disease
  Myasthenia gravis
• UniProt ID: F136A_HUMAN
• Pfam ID: PF05811
• Sequence:
  MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVP
  LAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMH
  LIPTMTKKMKEALLSIGK

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Meniere disease	DISC5R5F	Limited	Unknown	[1]
Myasthenia gravis	DISELRCI	Limited	Biomarker	[2]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein FAM136A (FAM136A).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein FAM136A (FAM136A).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM136A (FAM136A).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein FAM136A (FAM136A).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein FAM136A (FAM136A).	[7]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein FAM136A (FAM136A).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein FAM136A (FAM136A).	[9]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein FAM136A (FAM136A).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Protein FAM136A (FAM136A).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein FAM136A (FAM136A).	[11]

References

• [1] Identification of two novel mutations in FAM136A and DTNA genes in autosomal-dominant familial Meniere's disease. Hum Mol Genet. 2015 Feb 15;24(4):1119-26. doi: 10.1093/hmg/ddu524. Epub 2014 Oct 9.
• [2] Profiling of patient-specific myocytes identifies altered gene expression in the ophthalmoplegic subphenotype of myasthenia gravis.Orphanet J Rare Dis. 2019 Jan 29;14(1):24. doi: 10.1186/s13023-019-1003-y.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [6] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [7] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [8] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.