Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA4Y7EF)

DOT Name	Claudin-22 (CLDN22)
Gene Name	CLDN22
Related Disease	Squamous cell carcinoma ( )
UniProt ID	CLD22_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00822
Sequence	MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI LGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG CLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKH
Function	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
KEGG Pathway	Cell adhesion molecules (hsa04514 ) Tight junction (hsa04530 ) Leukocyte transendothelial migration (hsa04670 ) Pathogenic Escherichia coli infection (hsa05130 ) Hepatitis C (hsa05160 )
Reactome Pathway	Tight junction interactions (R-HSA-420029 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Claudin-22 (CLDN22).	[2]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Claudin-22 (CLDN22).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Claudin-22 (CLDN22).	[4]
------------------------------------------------------------------------------------

References

1	Differences in the early stage gene expression profiles of lung adenocarcinoma and lung squamous cell carcinoma.Oncol Lett. 2019 Dec;18(6):6572-6582. doi: 10.3892/ol.2019.11013. Epub 2019 Oct 21.
2	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
3	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
4	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.