Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAUFC2I)

• DOT Name: Nuclear pore complex-interacting protein family member A1 (NPIPA1)
• Synonyms: Nuclear pore complex-interacting protein; NPIP
• Gene Name: NPIPA1
• Related Disease: Pseudoxanthoma elasticum
• UniProt ID: NPIA1_HUMAN
• Pfam ID: PF06409
• Sequence:
  MFCCLGYEWLSGGCKTWHSAWVINTLADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCT
  SYLCVSFLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDIFTLWRQVETKVRAK
  IRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHT
  YMEMFQRAQALRRRAEDYYRCKITPSARKPLCNRVRMAAVEHRHSSGLPYWPYLTAETLK
  NRMGHQPPPPTQQHSIIDNSLSLKTPSECLLTPLPPSALPSADDNLKTPAECLLYPLPPS
  ADDNLKTPPECLLTPLPPSAPPSVDDNLKTPPECVCSLPFHPQRMIISRN
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Pseudoxanthoma elasticum	DIS8WUQG	Strong	Genetic Variation	[1]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[5]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[6]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[2]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[9]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Nuclear pore complex-interacting protein family member A1 (NPIPA1).	[10]

References

• [1] Identification of novel polymorphisms in the pM5 and MRP1 (ABCC1) genes at locus 16p13.1 and exclusion of both genes as responsible for pseudoxanthoma elasticum.Hum Mutat. 2001;17(1):74-5. doi: 10.1002/1098-1004(2001)17:1<74::AID-HUMU14>3.0.CO;2-F.
• [2] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [7] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [8] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.