Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAYGHDM)

DOT Name	Probable E3 ubiquitin-protein ligase MARCHF10 (MARCHF10)
Synonyms	EC 2.3.2.27; Membrane-associated RING finger protein 10; Membrane-associated RING-CH protein X; MARCH-X; RING finger protein 190; RING-type E3 ubiquitin transferase MARCHF10
Gene Name	MARCHF10
Related Disease	Type-1/2 diabetes ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Classic Hodgkin lymphoma ( ) Myocardial infarction ( ) Obesity ( ) Respiratory failure ( ) Schizophrenia ( ) Stroke ( ) Urinary tract infection ( ) Nervous system disease ( ) Tuberous sclerosis ( )
UniProt ID	MARHA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	2.3.2.27
Pfam ID	PF12906
Sequence	MLHDARDRQKFFSDVQYLRDMQHKVDSEYQACLRRQEYRRDPNEKKRDQFWGQETSFERS RFSSRSSSKQSSSEEDALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKV DPSEPSPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVPRGADQ VVQQEGLMCNTKLKRPNQERRNLVPSSQPMTENAPDRAKKGDPSAPSQSELHPALSQAFQ GKNSPQVLSEFSGPPLTPTTVGGPRKASFRFRDEDFYSILSLNSRRESDDTEEETQSEEC LWVGVRSPCSPSHHKRSRFGGTSTPQAKNKNFEENAENCRGHSSRRSEPSHGSLRISNAM EPATERPSAGQRLSQDPGLPDRESATEKDRGGSENAKKSPLSWDTKSEPRQEVGVNAENV WSDCISVEHRPGTHDSEGYWKDYLNSSQNSLDYFISGRPISPRSSVNSSYNPPASFMHSA LRDDIPVDLSMSSTSVHSSDSEGNSGFHVCQPLSPIRNRTPFASAENHNYFPVNSAHEFA VREAEDTTLTSQPQGAPLYTDLLLNPQGNLSLVDSSSSSPSRMNSEGHLHVSGSLQENTP FTFFAVSHFPNQNDNGSRMAASGFTDEKETSKIKADPEKLKKLQESLLEEDSEEEGDLCR ICQIAGGSPSNPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGAVKTCEMCKQGLLV DLGDFNMIEFYQKHQQSQAQNELMNSGLYLVLLLHLYEQRFAELMRLNHNQVERERLSRN YPQPRTEENENSELGDGNEGSISQSQVV
Function	E3 ubiquitin-protein ligase (Probable). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[2]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[2]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[3]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[4]
Obesity	DIS47Y1K	Strong	Biomarker	[5]
Respiratory failure	DISVMYJO	Strong	Biomarker	[6]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[7]
Stroke	DISX6UHX	Strong	Biomarker	[8]
Urinary tract infection	DISMT6UV	Strong	Biomarker	[9]
Nervous system disease	DISJ7GGT	moderate	Biomarker	[10]
Tuberous sclerosis	DISEMUGZ	moderate	Biomarker	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Probable E3 ubiquitin-protein ligase MARCHF10 (MARCHF10).	[11]
------------------------------------------------------------------------------------

References

1	Body surface area and glucose tolerance - The smaller the person, the greater the 2-hour plasma glucose.Diabetes Res Clin Pract. 2019 Nov;157:107877. doi: 10.1016/j.diabres.2019.107877. Epub 2019 Oct 14.
2	Nonvalidation of reported genetic risk factors for acute coronary syndrome in a large-scale replication study.JAMA. 2007 Apr 11;297(14):1551-61. doi: 10.1001/jama.297.14.1551.
3	Intensive treatment strategies in advanced-stage Hodgkin's lymphoma (HD9 and HD12): analysis of long-term survival in two randomised trials.Lancet Haematol. 2018 Oct;5(10):e462-e473. doi: 10.1016/S2352-3026(18)30140-6.
4	Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
5	Science-based solutions to obesity: what are the roles of academia, government, industry, and health care?.Am J Clin Nutr. 2005 Jul;82(1 Suppl):207S-210S. doi: 10.1093/ajcn/82.1.207S.
6	Effect of Ganciclovir on IL-6 Levels Among Cytomegalovirus-Seropositive Adults With Critical Illness: A Randomized Clinical Trial.JAMA. 2017 Aug 22;318(8):731-740. doi: 10.1001/jama.2017.10569.
7	Psychological interventions for post-traumatic stress disorder (PTSD) in people with severe mental illness.Cochrane Database Syst Rev. 2017 Jan 24;1(1):CD011464. doi: 10.1002/14651858.CD011464.pub2.
8	Burden, clinical outcomes and predictors of time to in hospital mortality among adult patients admitted to stroke unit of Jimma university medical center: a prospective cohort study.BMC Neurol. 2019 Aug 30;19(1):213. doi: 10.1186/s12883-019-1439-7.
9	Prevalence and predictive factors of urinary tract infection among patients with stroke: A meta-analysis.Am J Infect Control. 2018 Apr;46(4):402-409. doi: 10.1016/j.ajic.2017.10.001. Epub 2017 Nov 16.
10	Advances and Future Directions for Tuberous Sclerosis Complex Research: Recommendations From the 2015 Strategic Planning Conference.Pediatr Neurol. 2016 Jul;60:1-12. doi: 10.1016/j.pediatrneurol.2016.03.015. Epub 2016 Apr 2.
11	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.