Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB24J5O)

• DOT Name: Keratinocyte-associated protein 3 (KRTCAP3)
• Synonyms: KCP-3
• Gene Name: KRTCAP3
• Related Disease: Gout
• UniProt ID: KCP3_HUMAN
• Pfam ID: PF12304
• Sequence:
  MRRCSLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTV
  ANVISVGSGLLSVSVGLVALLASRNLLRPPLHWVLLALALVNLLLSVACSLGLLLAVSLT
  VANGGRRLIADCHPGLLDPLVPLDEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEAAL
  SGYCCVAALTLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV
• Tissue Specificity: Expressed in skin, pancreas and keratinocytes.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gout	DISHC0U7	Strong	Genetic Variation	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Keratinocyte-associated protein 3 (KRTCAP3).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Keratinocyte-associated protein 3 (KRTCAP3).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Keratinocyte-associated protein 3 (KRTCAP3).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Keratinocyte-associated protein 3 (KRTCAP3).	[5]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Keratinocyte-associated protein 3 (KRTCAP3).	[6]

References

• [1] Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.