Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB82I9W)

• DOT Name: Tripartite motif-containing protein 49 (TRIM49)
• Synonyms: RING finger protein 18; Testis-specific RING-finger protein
• Gene Name: TRIM49
• UniProt ID: TRI49_HUMAN
• Pfam ID: PF00622 ; PF00643 ; PF15227
• Sequence:
  MNSGILQVFQGELICPLCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTE
  QINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQE
  HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIR
  AEYQKMPAFHHEEEKHNLEMLKKKGKEIFHRLHLSKAKMAHRMEILRGMYEELNEMCHKP
  DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDI
  FLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGKYYWEVHVGDSWNWAFGVCNM
  YRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV
  SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF
• Tissue Specificity: Preferentially expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tripartite motif-containing protein 49 (TRIM49).	[1]
EPZ-004777	DMLN4V5	Investigative	EPZ-004777 decreases the expression of Tripartite motif-containing protein 49 (TRIM49).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Tripartite motif-containing protein 49 (TRIM49).	[2]

References

• [1] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [2] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [3] Histone methyltransferase DOT1L coordinates AR and MYC stability in prostate cancer. Nat Commun. 2020 Aug 19;11(1):4153. doi: 10.1038/s41467-020-18013-7.