Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB94PY2)

DOT Name	IgLON family member 5 (IGLON5)
Gene Name	IGLON5
Related Disease	Aicardi-Goutieres syndrome ( ) Cerebellar ataxia ( ) Choreatic disease ( ) Encephalitis ( ) Movement disorder ( ) Progressive supranuclear palsy ( ) Sleep disorder ( ) Tauopathy ( ) Nervous system disease ( )
UniProt ID	IGLO5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	6DLD; 6DLE
Pfam ID	PF00047 ; PF13927
Sequence	MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHV TRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQP YTTQVYLIVHVPARIVNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEIL EISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEA MAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGAS SASMRLLRPGSLENSAPRPPGLLALLSALGWLWWRM

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Aicardi-Goutieres syndrome	DIS1NH4X	Strong	Biomarker	[1]
Cerebellar ataxia	DIS9IRAV	Strong	Biomarker	[2]
Choreatic disease	DISH8K3M	Strong	Biomarker	[2]
Encephalitis	DISLD1RL	Strong	Biomarker	[3]
Movement disorder	DISOJJ2D	Strong	Biomarker	[4]
Progressive supranuclear palsy	DISO5KRQ	Strong	Biomarker	[3]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[5]
Tauopathy	DISY2IPA	Strong	Biomarker	[6]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of IgLON family member 5 (IGLON5).	[8]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of IgLON family member 5 (IGLON5).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of IgLON family member 5 (IGLON5).	[10]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of IgLON family member 5 (IGLON5).	[11]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of IgLON family member 5 (IGLON5).	[12]
------------------------------------------------------------------------------------

References

1	Stiff person syndrome and other immune-mediated movement disorders - new insights.Curr Opin Neurol. 2016 Aug;29(4):496-506. doi: 10.1097/WCO.0000000000000351.
2	Antibody-associated CNS syndromes without signs of inflammation in the elderly.Neurology. 2017 Oct 3;89(14):1471-1475. doi: 10.1212/WNL.0000000000004541. Epub 2017 Sep 6.
3	IgLON5-Associated Encephalitis With Atypical Brain Magnetic Resonance Imaging and Cerebrospinal Fluid Changes.Front Neurol. 2018 May 17;9:329. doi: 10.3389/fneur.2018.00329. eCollection 2018.
4	Autoimmune encephalitis with anti-IgLON5 and anti-GABAB-receptor antibodies: A case report.Medicine (Baltimore). 2019 May;98(20):e15706. doi: 10.1097/MD.0000000000015706.
5	The Sleep Disorder in Anti-lgLON5 Disease.Curr Neurol Neurosci Rep. 2018 May 23;18(7):41. doi: 10.1007/s11910-018-0848-0.
6	Movement disorders with neuronal antibodies: syndromic approach, genetic parallels and pathophysiology.Brain. 2018 Jan 1;141(1):13-36. doi: 10.1093/brain/awx189.
7	Anti-IgLON 5 Disease.Curr Treat Options Neurol. 2018 Jun 23;20(8):29. doi: 10.1007/s11940-018-0515-4.
8	The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
9	Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
10	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
11	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.