Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC6QPW3)

• DOT Name: Vesicle transport protein GOT1B (GOLT1B)
• Synonyms: Germ cell tumor 2; Golgi transport 1 homolog B; Putative NF-kappa-B-activating protein 470; hGOT1a
• Gene Name: GOLT1B
• Related Disease:
  Seminoma
  Acute myelogenous leukaemia
  Plasma cell myeloma
• UniProt ID: GOT1B_HUMAN
• Pfam ID: PF04178
• Sequence:
  MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFF
  QKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLN
  LPGIRSFVDKVGESNNMV
• Function: May be involved in fusion of ER-derived transport vesicles with the Golgi complex.
• Tissue Specificity: Widely expressed. Tends to be up-regulated in seminomas compared to normal testis.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Seminoma	DIS3J8LJ	Strong	Altered Expression	[1]
Acute myelogenous leukaemia	DISCSPTN	moderate	Biomarker	[2]
Plasma cell myeloma	DIS0DFZ0	moderate	Genetic Variation	[2]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Vesicle transport protein GOT1B (GOLT1B).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Vesicle transport protein GOT1B (GOLT1B).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Vesicle transport protein GOT1B (GOLT1B).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Vesicle transport protein GOT1B (GOLT1B).	[6]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Vesicle transport protein GOT1B (GOLT1B).	[7]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Vesicle transport protein GOT1B (GOLT1B).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Vesicle transport protein GOT1B (GOLT1B).	[10]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Vesicle transport protein GOT1B (GOLT1B).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Vesicle transport protein GOT1B (GOLT1B).	[9]

References

• [1] Genomic and expression analysis of the 12p11-p12 amplicon using EST arrays identifies two novel amplified and overexpressed genes.Cancer Res. 2002 Nov 1;62(21):6218-23.
• [2] Intermediate-dose cytarabine plus G-CSF as mobilization regimen for newly diagnosed multiple myeloma and heavily pre-treated patients with hematological and non-hematological malignancies.Transfus Apher Sci. 2019 Jun;58(3):318-322. doi: 10.1016/j.transci.2019.03.018. Epub 2019 Mar 29.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [8] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [9] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.