Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCJUHYV)

• DOT Name: Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2)
• Synonyms: Rhodanese domain-containing protein 2
• Gene Name: TSTD2
• UniProt ID: TSTD2_HUMAN
• Pfam ID: PF00581 ; PF12368 ; PF17773
• Sequence:
  MPSSTSPDQGDDLENCILRFSDLDLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALF
  VKTKEVPTKRSFECKEKLWKCCRQLFTDQTSIHRHVATQHADEIYHQTASILKQLAVTLS
  TSKSLSSADEKNPLKECLPHSHDVSAWLPDISCFNPDELISGQGSEEGEVLLYYCYHDLE
  DPQWICAWQTALCQHLHLTGKIRIAAEGINGTVGGSKLATRLYVEVMLSFPLFKDDLCKD
  DFKTSKGGAHCFPELRVGVFEEIVPMGISPKKISYKKPGIHLSPGEFHKEVEKFLSQANQ
  EQSDTILLDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIR
  CERGSAYLKAKGVCKEVFQLKGGIHKYLEEFPDGFYKGKLFVFDERYALSYNSDVVSECS
  YCGARWDQYKLCSTPQCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECE
  CTARRPRIPRELLQHVRQPVSPEPGPDADEDGPVLM

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2).	[6]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.