Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCQVOXB)

• DOT Name: Protein FAM72D (FAM72D)
• Synonyms: Gastric cancer up-regulated protein 2
• Gene Name: FAM72D
• Related Disease: Plasma cell myeloma
• UniProt ID: FA72D_HUMAN
• Pfam ID: PF14976
• Sequence:
  MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
  FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGV
  NVLLRGNLPEIEESTDEDVLNISAEECIR

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein FAM72D (FAM72D).	[2]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM72D (FAM72D).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein FAM72D (FAM72D).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein FAM72D (FAM72D).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Protein FAM72D (FAM72D).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein FAM72D (FAM72D).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein FAM72D (FAM72D).	[7]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Protein FAM72D (FAM72D).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein FAM72D (FAM72D).	[9]

References

• [1] The hydroxymethylome of multiple myeloma identifies FAM72D as a 1q21 marker linked to proliferation.Haematologica. 2020 Mar;105(3):774-783. doi: 10.3324/haematol.2019.222133. Epub 2019 Jun 20.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [6] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.