General Information of Drug Off-Target (DOT) (ID: OTCWSM5T)

DOT Name Proline-rich protein 3 (PRR3)
Synonyms MHC class I region proline-rich protein CAT56
Gene Name PRR3
Related Disease
Graves disease ( )
UniProt ID
PRR3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00642
Sequence
MPKRKKQNHHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHR
GPPGSRGPLIPPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTR
GSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDLCAFYH
PGVNGPPL

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Graves disease DISU4KOQ Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Arsenic trioxide DM61TA4 Approved Proline-rich protein 3 (PRR3) increases the response to substance of Arsenic trioxide. [10]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Proline-rich protein 3 (PRR3). [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Proline-rich protein 3 (PRR3). [3]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Proline-rich protein 3 (PRR3). [4]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Proline-rich protein 3 (PRR3). [5]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Proline-rich protein 3 (PRR3). [5]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Proline-rich protein 3 (PRR3). [6]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Proline-rich protein 3 (PRR3). [7]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Proline-rich protein 3 (PRR3). [8]
QUERCITRIN DM1DH96 Investigative QUERCITRIN decreases the expression of Proline-rich protein 3 (PRR3). [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Single nucleotide polymorphisms at the PRR3, ABCF1, and GNL1 genes in the HLA class I region are associated with Graves' ophthalmopathy in a gender-dependent manner.Ophthalmology. 2014 Oct;121(10):2033-9. doi: 10.1016/j.ophtha.2014.04.027. Epub 2014 Jun 5.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
6 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
9 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
10 The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.