Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDBOZEN)

DOT Name	Metallothionein-4 (MT4)
Synonyms	MT-4; Metallothionein-IV; MT-IV
Gene Name	MT4
Related Disease	Nephropathy ( ) Non-small-cell lung cancer ( )
UniProt ID	MT4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00131
Sequence	MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSC CP
Function	Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
Reactome Pathway	Metallothioneins bind metals (R-HSA-5661231 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Nephropathy	DISXWP4P	Strong	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Metallothionein-4 (MT4).	[3]
------------------------------------------------------------------------------------

References

1	The association of metallothionein-4 gene polymorphism and renal function in long-term lead-exposed workers.Biol Trace Elem Res. 2010 Oct;137(1):55-62. doi: 10.1007/s12011-009-8564-x. Epub 2009 Nov 17.
2	Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.Exp Mol Pathol. 2013 Feb;94(1):301-8. doi: 10.1016/j.yexmp.2012.10.006. Epub 2012 Oct 9.
3	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.