Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDGVXJ6)

DOT Name Major intrinsically disordered NOTCH2-binding receptor 1-like (MINAR2)
Synonyms Major intrinsically disordered NOTCH2-associated receptor 2; Membrane integral NOTCH2-associated receptor 2
Gene Name MINAR2
Related Disease
Hearing loss, autosomal recessive 120 ( )
UniProt ID
MNARL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF06789
Sequence
MDLSVLPNNNHPDKFLQLDVKSLTRSSALLQASLVRFPGGNYPAAQHWQNLVYSQREKKN
IAAQRIRGSSADSLVTADSPPPSMSSVMKNNPLYGDLSLEEAMEERKKNPSWTIEEYDKH
SLHTNLSGHLKENPNDLRFWLGDMYTPGFDTLLKKEEKQEKHSKFCRMGLILLVVISILV
TIVTIITFFT
Function Binds cholesterol and may regulate the distribution and homeostasis of cholesterol in hair cells. May play a role in angiogenesis.
Tissue Specificity Highly expressed in the auditory hair cells.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hearing loss, autosomal recessive 120 DISHV05H Limited Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Major intrinsically disordered NOTCH2-binding receptor 1-like (MINAR2). [2]
Permethrin DMZ0Q1G Approved Permethrin decreases the expression of Major intrinsically disordered NOTCH2-binding receptor 1-like (MINAR2). [3]
------------------------------------------------------------------------------------

References

1 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
3 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.