Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDWY1RO)

• DOT Name: Putative protein MSS51 homolog, mitochondrial (MSS51)
• Synonyms: Zinc finger MYND domain-containing protein 17
• Gene Name: MSS51
• Related Disease:
  Schizophrenia
  Obesity
  Type-1/2 diabetes
• UniProt ID: MSS51_HUMAN
• Pfam ID: PF20179 ; PF01753
• Sequence:
  MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQL
  ILQKLNMKSYEEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKV
  LRHCKRCRNVYYCGPECQKSDWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWP
  PEAVQDWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVL
  SRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRPGDYDELGYMFPGHLGLRVVM
  VGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHS
  SPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAFGSNPFMSLKPE
  QVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Schizophrenia	DISSRV2N	Strong	Biomarker	[1]
Obesity	DIS47Y1K	moderate	Biomarker	[2]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Putative protein MSS51 homolog, mitochondrial (MSS51).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Putative protein MSS51 homolog, mitochondrial (MSS51).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Putative protein MSS51 homolog, mitochondrial (MSS51).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Putative protein MSS51 homolog, mitochondrial (MSS51).	[7]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative protein MSS51 homolog, mitochondrial (MSS51).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Putative protein MSS51 homolog, mitochondrial (MSS51).	[8]

References

• [1] ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes at chromosome 10q22 associated with the subgroup of schizophrenia with deficits in attention and executive function.Biol Psychiatry. 2011 Jul 1;70(1):51-8. doi: 10.1016/j.biopsych.2011.02.033. Epub 2011 Apr 30.
• [2] Mss51 deletion enhances muscle metabolism and glucose homeostasis in mice.JCI Insight. 2019 Oct 17;4(20):e122247. doi: 10.1172/jci.insight.122247.
• [3] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] MCM5 as a target of BET inhibitors in thyroid cancer cells. Endocr Relat Cancer. 2016 Apr;23(4):335-47. doi: 10.1530/ERC-15-0322. Epub 2016 Feb 24.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.