Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE0GI4W)

DOT Name	Zinc transporter ZIP2 (SLC39A2)
Synonyms	6A1; Eti-1; Solute carrier family 39 member 2; Zrt- and Irt-like protein 2; ZIP-2; hZIP2
Gene Name	SLC39A2
UniProt ID	S39A2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF02535
Sequence	MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAG FMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE SLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEG LAVGLQPTVAATVQLCLAVLAHKGLVVFGVGMRLVHLGTSSRWAVFSILLLALMSPLGLA VGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPRELASPEAPLAKWSCVAAGFA FMAFIALWA
Function	Transporter for the divalent cation Zn(2+). Mediates the influx of Zn(2+) into cells from extracellular space. The Zn(2+) uniporter activity is independent of H(+)-driving force, but is modulated by extracellular pH and membrane potential. Transports also other divalent cations Zn(2+), Cd2(+), Cu2(+), Co2(+) in the order of decreasing affinity, respectively. In the skin, aids in the differentiation of keratinocytes in the epidermis.
Tissue Specificity	Expressed only in prostate and uterine epithelial cells.
KEGG Pathway	Alzheimer disease (hsa05010 ) Parkinson disease (hsa05012 )
Reactome Pathway	Zinc influx into cells by the SLC39 gene family (R-HSA-442380 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Zinc transporter ZIP2 (SLC39A2) increases the response to substance of Arsenic.	[9]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Zinc transporter ZIP2 (SLC39A2).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Zinc transporter ZIP2 (SLC39A2).	[7]
------------------------------------------------------------------------------------

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Zinc transporter ZIP2 (SLC39A2).	[2]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Zinc transporter ZIP2 (SLC39A2).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Zinc transporter ZIP2 (SLC39A2).	[4]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Zinc transporter ZIP2 (SLC39A2).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Zinc transporter ZIP2 (SLC39A2).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Zinc transporter ZIP2 (SLC39A2).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Vitamin D3 transactivates the zinc and manganese transporter SLC30A10 via the Vitamin D receptor. J Steroid Biochem Mol Biol. 2016 Oct;163:77-87.
3	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
4	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
5	Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
6	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
9	SLC39A2 and FSIP1 polymorphisms as potential modifiers of arsenic-related bladder cancer. Hum Genet. 2012 Mar;131(3):453-61. doi: 10.1007/s00439-011-1090-x. Epub 2011 Sep 25.