Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE0Z7WM)

• DOT Name: Protein DGCR6L (DGCR6L)
• Synonyms: DiGeorge syndrome critical region 6-like protein
• Gene Name: DGCR6L
• Related Disease:
  DiGeorge syndrome
  Velocardiofacial syndrome
• UniProt ID: DGC6L_HUMAN
• Pfam ID: PF07324
• Sequence:
  MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTV
  FEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQ
  RELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLL
  ELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP
• Function: May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.
• Tissue Specificity: Widely expressed in fetal and adult tissues. Highest expression in liver, heart and skeletal muscle. Lower levels in pancreas and placenta. Weak expression in brain.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
DiGeorge syndrome	DIST1RKO	Strong	Biomarker	[1]
Velocardiofacial syndrome	DISOSBTY	Strong	Biomarker	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Protein DGCR6L (DGCR6L).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein DGCR6L (DGCR6L).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein DGCR6L (DGCR6L).	[4]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Protein DGCR6L (DGCR6L).	[5]

References

• [1] Biochemical characterisation of the proteins encoded by the DiGeorge critical region 6 (DGCR6) genes.Hum Genet. 2005 Jun;117(1):70-80. doi: 10.1007/s00439-005-1267-2. Epub 2005 Apr 9.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.