Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE32B3V)

DOT Name Vesicle transport protein SFT2B (SFT2D2)
Synonyms SFT2 domain-containing protein 2
Gene Name SFT2D2
UniProt ID
SFT2B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04178
Sequence
MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRK
GLHLFAVFYTFGNIASIGSTIFLMGPVKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWH
NKGLALIFCILQSLALTWYSLSFIPFARDAVKKCFAVCLA
Function May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Vesicle transport protein SFT2B (SFT2D2). [1]
Quercetin DM3NC4M Approved Quercetin increases the expression of Vesicle transport protein SFT2B (SFT2D2). [2]
Marinol DM70IK5 Approved Marinol increases the expression of Vesicle transport protein SFT2B (SFT2D2). [3]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Vesicle transport protein SFT2B (SFT2D2). [4]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Vesicle transport protein SFT2B (SFT2D2). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Vesicle transport protein SFT2B (SFT2D2). [2]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Vesicle transport protein SFT2B (SFT2D2). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
2 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
4 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.