Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEEQGR7)

DOT Name N-alpha-acetyltransferase 11 (NAA11)
Synonyms EC 2.3.1.255; N-terminal acetyltransferase complex ARD1 subunit homolog B; hARD2; NatA catalytic subunit Naa11
Gene Name NAA11
Related Disease
Hepatocellular carcinoma ( )
UniProt ID
NAA11_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.1.255
Pfam ID
PF00583
Sequence
MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALH
LYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQET
QGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSESSDSTS
Function Displays alpha (N-terminal) acetyltransferase activity. Proposed alternative catalytic subunit of the N-terminal acetyltransferase A (NatA) complex.
Tissue Specificity Present in several cell lines, with highest levels in MCF-7 cells (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of N-alpha-acetyltransferase 11 (NAA11). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of N-alpha-acetyltransferase 11 (NAA11). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of N-alpha-acetyltransferase 11 (NAA11). [4]
------------------------------------------------------------------------------------

References

1 LOH analysis of genes around D4S2964 identifies ARD1B as a prognostic predictor of hepatocellular carcinoma.World J Gastroenterol. 2010 Apr 28;16(16):2046-54. doi: 10.3748/wjg.v16.i16.2046.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Gene expression profiling of A549 cells exposed to Milan PM2.5. Toxicol Lett. 2012 Mar 7;209(2):136-45.