Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEMY28K)

• DOT Name: Distal membrane-arm assembly complex protein 1 (DMAC1)
• Synonyms: Transmembrane protein 261
• Gene Name: DMAC1
• UniProt ID: DMAC1_HUMAN
• Pfam ID: PF15055
• Sequence:
  MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMG
  AGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV
• Function: Required for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Involved in the assembly of the distal region of complex I.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[8]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Distal membrane-arm assembly complex protein 1 (DMAC1).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [9] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.