Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTES4QKG)

• DOT Name: Protein FAM131B (FAM131B)
• Gene Name: FAM131B
• Related Disease: Brain neoplasm
• UniProt ID: F131B_HUMAN
• Pfam ID: PF15010
• Sequence:
  MDSTSSLHGSSLHRPSTEQTRTDFSWDGINLSMEDTTSILPKLKRNSNAYGIGALAKSSF
  SGISRSMKDHVTKPTAMGQGRVAHMIEWQGWGKTPAVQPQHSHESVRRDTDAYSDLSDGE
  KEARFLAGVMEQFAISEATLMAWSSMDGEDMSVNSTQEPLGCNYSDNYQELMDSQDALAQ
  APMDGWPHSYVSQGMYCLGSSDAWEASDQSLIASPATGSYLGPAFDDSQPSLHEMGPSQP
  ASGYSALEPPPLLGGDTDWAPGVGAVDLARGPAEEEKRPLAPEEEEDAGCRDLESLSPRE
  DPEMSTALSRKVSDVTSSGVQSFDEEEGEANN
• Reactome Pathway: Signaling by BRAF and RAF1 fusions (R-HSA-6802952)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Brain neoplasm	DISY3EKS	Strong	Genetic Variation	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein FAM131B (FAM131B).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein FAM131B (FAM131B).	[7]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM131B (FAM131B).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein FAM131B (FAM131B).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein FAM131B (FAM131B).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein FAM131B (FAM131B).	[5]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Protein FAM131B (FAM131B).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein FAM131B (FAM131B).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein FAM131B (FAM131B).	[9]

References

• [1] Copy number alterations determined by single nucleotide polymorphism array testing in the clinical laboratory are indicative of gene fusions in pediatric cancer patients.Genes Chromosomes Cancer. 2017 Oct;56(10):730-749. doi: 10.1002/gcc.22477. Epub 2017 Jul 1.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [6] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.