Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTET3S6H)

• DOT Name: LYR motif-containing protein 2 (LYRM2)
• Gene Name: LYRM2
• Related Disease:
  Colorectal carcinoma
  Neoplasm
• UniProt ID: LYRM2_HUMAN
• Pfam ID: PF05347
• Sequence:
  MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSAT
  EEDTIRMMITQGNMQLKELEKTLALAKS
• Function: Involved in efficient integration of the N-module into mitochondrial respiratory chain complex I.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of LYR motif-containing protein 2 (LYRM2).	[2]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of LYR motif-containing protein 2 (LYRM2).	[4]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of LYR motif-containing protein 2 (LYRM2).	[7]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic decreases the methylation of LYR motif-containing protein 2 (LYRM2).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of LYR motif-containing protein 2 (LYRM2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of LYR motif-containing protein 2 (LYRM2).	[6]

References

• [1] LYRM2 directly regulates complex I activity to support tumor growth in colorectal cancer by oxidative phosphorylation.Cancer Lett. 2019 Jul 28;455:36-47. doi: 10.1016/j.canlet.2019.04.021. Epub 2019 Apr 17.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Epigenome-Wide Assessment of DNA Methylation in the Placenta and Arsenic Exposure in the New Hampshire Birth Cohort Study (USA). Environ Health Perspect. 2016 Aug;124(8):1253-60. doi: 10.1289/ehp.1510437. Epub 2016 Jan 15.
• [4] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.