Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTF4JYGZ)
| DOT Name | Potassium voltage-gated channel subfamily E regulatory beta subunit 5 (KCNE5) | ||||
|---|---|---|---|---|---|
| Synonyms | AMME syndrome candidate gene 2 protein; Potassium channel subunit beta MiRP4; Potassium voltage-gated channel subfamily E member 1-like protein | ||||
| Gene Name | KCNE5 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAY
LYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQ AEGRRQLASEGLPALAQGAERV |
||||
| Function |
Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1.
|
||||
| Tissue Specificity | Highly expressed in heart, skeletal muscle, brain, spinal cord and placenta. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
6 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
