Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF7NGFF)

• DOT Name: PRELI domain-containing protein 2 (PRELID2)
• Gene Name: PRELID2
• UniProt ID: PRLD2_HUMAN
• Pfam ID: PF04707
• Sequence:
  MGVSVDVHQVYKYPFEQVVASFLRKYPNPMDKNVISVKIMEEKRDESTGVIYRKRIAICQ
  NVVPEILRKSLSTLVILCWKKVSILKVPNIQLEEESWLNPRERNMAIRSHCLTWTQYASM
  KEESVFRESMENPNWTEFIQRGRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLK
  EQCGAPLAE

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of PRELI domain-containing protein 2 (PRELID2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin affects the expression of PRELI domain-containing protein 2 (PRELID2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of PRELI domain-containing protein 2 (PRELID2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of PRELI domain-containing protein 2 (PRELID2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of PRELI domain-containing protein 2 (PRELID2).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of PRELI domain-containing protein 2 (PRELID2).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of PRELI domain-containing protein 2 (PRELID2).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.