Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTG15W80)
| DOT Name | IgA-inducing protein homolog (IGIP) | ||||
|---|---|---|---|---|---|
| Gene Name | IGIP | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS
|
||||
| Function | Enhances IgA secretion from B-cells stimulated via CD40. | ||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
7 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
