Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG15W80)

DOT Name IgA-inducing protein homolog (IGIP)
Gene Name IGIP
UniProt ID
IGIP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS
Function Enhances IgA secretion from B-cells stimulated via CD40.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of IgA-inducing protein homolog (IGIP). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of IgA-inducing protein homolog (IGIP). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of IgA-inducing protein homolog (IGIP). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of IgA-inducing protein homolog (IGIP). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of IgA-inducing protein homolog (IGIP). [5]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of IgA-inducing protein homolog (IGIP). [6]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of IgA-inducing protein homolog (IGIP). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
7 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.