Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG9XX92)

DOT Name	Ankyrin repeat domain-containing protein 49 (ANKRD49)
Synonyms	Fetal globin-inducing factor
Gene Name	ANKRD49
Related Disease	Glioma ( ) Malignant glioma ( ) Gastric cancer ( ) Neoplasm ( ) Stomach cancer ( )
UniProt ID	ANR49_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00023 ; PF12796
Sequence	MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNE EWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGH LDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL AAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS
Function	Induces HBG1 expression. May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway.
Tissue Specificity	Widely expressed in fetus, at a high level in fetal liver, brain and lung.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Glioma	DIS5RPEH	Strong	Biomarker	[1]
Malignant glioma	DISFXKOV	Strong	Biomarker	[1]
Gastric cancer	DISXGOUK	Limited	Biomarker	[2]
Neoplasm	DISZKGEW	Limited	Altered Expression	[2]
Stomach cancer	DISKIJSX	Limited	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Ankyrin repeat domain-containing protein 49 (ANKRD49).	[3]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ankyrin repeat domain-containing protein 49 (ANKRD49).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ankyrin repeat domain-containing protein 49 (ANKRD49).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ankyrin repeat domain-containing protein 49 (ANKRD49).	[6]
------------------------------------------------------------------------------------

References

1	Up-regulation of ANKDR49, a poor prognostic factor, regulates cell proliferation of gliomas.Biosci Rep. 2017 Aug 4;37(4):BSR20170800. doi: 10.1042/BSR20170800. Print 2017 Aug 31.
2	High expression of the ANKRD49 protein is associated with progression and poor prognosis of gastric cancer.Cancer Biomark. 2018;22(4):649-656. doi: 10.3233/CBM-171074.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.