Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGDNI2L)

• DOT Name: Probable UDP-sugar transporter protein SLC35A4 (SLC35A4)
• Synonyms: Solute carrier family 35 member A4
• Gene Name: SLC35A4
• UniProt ID: S35A4_HUMAN
• Pfam ID: PF04142
• Sequence:
  MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELT
  KLLLCAFSLLVGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSN
  LKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPM
  PLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGG
  SGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRL
  QLTAAFFLATLLIGLAMRLYYGSR
• Function: Mediates the transport of CDP-ribitol. Does not exhibit CMP-sialic acid, UDP-galactose and UDP-N-acetylglucosamine transport activity.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[5]
Marinol	DM70IK5	Approved	Marinol increases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[6]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Probable UDP-sugar transporter protein SLC35A4 (SLC35A4).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [7] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [8] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.