Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGES18F)

DOT Name	Allograft inflammatory factor 1 (AIF1)
Synonyms	AIF-1; Ionized calcium-binding adapter molecule 1; Protein G1
Gene Name	AIF1
UniProt ID	AIF1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2D58; 2G2B
Pfam ID	PF21008
Sequence	MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM ILMYEEKAREKEKPTGPPAKKAISELP
Function	Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Tissue Specificity	Detected in T-lymphocytes and peripheral blood mononuclear cells.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sodium lauryl sulfate	DMLJ634	Approved	Allograft inflammatory factor 1 (AIF1) affects the response to substance of Sodium lauryl sulfate.	[7]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Allograft inflammatory factor 1 (AIF1).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Allograft inflammatory factor 1 (AIF1).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Allograft inflammatory factor 1 (AIF1).	[3]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Allograft inflammatory factor 1 (AIF1).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Allograft inflammatory factor 1 (AIF1).	[5]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Allograft inflammatory factor 1 (AIF1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Allograft inflammatory factor 1 (AIF1).	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
2	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3	Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
4	Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
6	Benzo(a)pyrene exposure in utero exacerbates Parkinson's Disease (PD)-like -synucleinopathy in A53T human alpha-synuclein transgenic mice. Toxicol Appl Pharmacol. 2021 Sep 15;427:115658. doi: 10.1016/j.taap.2021.115658. Epub 2021 Jul 29.
7	Association of MHC region SNPs with irritant susceptibility in healthcare workers. J Immunotoxicol. 2016 Sep;13(5):738-44. doi: 10.3109/1547691X.2016.1173135. Epub 2016 Jun 3.