Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGR7BCP)

• DOT Name: Serpin-like protein HMSD (HMSD)
• Synonyms: Minor histocompatibility protein HMSD; Minor histocompatibility serpin domain-containing protein
• Gene Name: HMSD
• Related Disease:
  Aplasia cutis congenita
  Corpus callosum, agenesis of
• UniProt ID: HMSD_HUMAN
• Pfam ID: PF00079
• Sequence:
  MSISSALAMVFMGAKGNTAAQMSQALCFSKIGGEDGDIHRGFQSLLVAINRTDTEYVLRT
  ANGLFGEKSYDFLTGFTDSCGKFYQATIKQLDFVNDTEKSTTRVNSWVADKTKGENILLF
  YFDNILNSFIVSSLQNCQI
• Function: Putative serine protease inhibitor.
• Tissue Specificity: Highly expressed in dendritic cells and primary leukemia cells, especially those of myeloid lineage.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[1]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Serpin-like protein HMSD (HMSD).	[2]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Serpin-like protein HMSD (HMSD).	[3]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Serpin-like protein HMSD (HMSD).	[3]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Serpin-like protein HMSD (HMSD).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Serpin-like protein HMSD (HMSD).	[4]

References

• [1] Downregulation of runt-related transcription factor 3 associated with poor prognosis of adenoid cystic and mucoepidermoid carcinomas of the salivary gland.Cancer Sci. 2011 Feb;102(2):492-7. doi: 10.1111/j.1349-7006.2010.01787.x. Epub 2010 Nov 24.
• [2] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [3] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.