Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGS9FH5)

DOT Name Small integral membrane protein 7 (SMIM7)
Gene Name SMIM7
UniProt ID
SMIM7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIAL
WNIFMMFCMIVLFGS

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Small integral membrane protein 7 (SMIM7). [1]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Small integral membrane protein 7 (SMIM7). [2]
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Small integral membrane protein 7 (SMIM7). [3]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Small integral membrane protein 7 (SMIM7). [4]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Small integral membrane protein 7 (SMIM7). [5]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Small integral membrane protein 7 (SMIM7). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 A comparative transcriptomic study on the effects of valproic acid on two different hESCs lines in a neural teratogenicity test system. Toxicol Lett. 2014 Nov 18;231(1):38-44.
2 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.