Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGUD2XL)

• DOT Name: Chromodomain Y-like protein 2 (CDYL2)
• Synonyms: CDY-like 2
• Gene Name: CDYL2
• Related Disease:
  Breast cancer
  Breast carcinoma
  Inflammatory bowel disease
• UniProt ID: CDYL2_HUMAN
• PDB ID: 2MJ8; 4HAE; 5JJZ; 6V2D; 6V2H; 6V3N; 6V8W; 7SLW
• Pfam ID: PF00385 ; PF00378
• Sequence:
  MASGDLYEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHM
  SKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGY
  SGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENGDAGSEKDERHFGNGSHQPGLD
  LNDHVGEQDMGECDVNHATLAENGLGSALTNGGLNLHSPVKRKLEAEKDYVFDKRLRYSV
  RQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLL
  SAVGSVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGL
  GASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQ
  EACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECL
  MLKQLWSSSKGLDSLFSYLQDKIYEV
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[1]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[2]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[3]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Chromodomain Y-like protein 2 (CDYL2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Chromodomain Y-like protein 2 (CDYL2).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Chromodomain Y-like protein 2 (CDYL2).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Chromodomain Y-like protein 2 (CDYL2).	[7]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Chromodomain Y-like protein 2 (CDYL2).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Chromodomain Y-like protein 2 (CDYL2).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Chromodomain Y-like protein 2 (CDYL2).	[10]

References

• [1] Large-scale genotyping identifies 41 new loci associated with breast cancer risk.Nat Genet. 2013 Apr;45(4):353-61, 361e1-2. doi: 10.1038/ng.2563.
• [2] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [3] Identification of Loci at 1q21 and 16q23 That Affect Susceptibility to Inflammatory Bowel Disease in Koreans.Gastroenterology. 2016 Dec;151(6):1096-1099.e4. doi: 10.1053/j.gastro.2016.08.025. Epub 2016 Aug 26.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [6] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [9] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [10] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.