| DOT Name | 
                
                    Interferon alpha-4 (IFNA4)
                 | 
            
             
                        
                | Synonyms | 
                
                     IFN-alpha-4; Interferon alpha-4B; Interferon alpha-76; Interferon alpha-M1                  | 
            
             
                        
                | Gene Name | 
                
                    IFNA4
                 | 
            
             
                        
                | Related Disease | 
                
                                        
                        
                                                        - Crohn disease ( )
 
                                                        - Hepatitis C virus infection ( )
 
                                                        - Addison disease ( )
 
                                                        - Neoplasm ( )
 
                                                     
                        
                     
                                     | 
            
             
             
                        
                | UniProt ID | 
                
                    
                 | 
            
             
                        
                | 3D Structure | 
                
                    
                    
                 | 
            
             
             
             
                                    
                | Pfam ID | 
                
                    
                 | 
            
             
                        
                | Sequence | 
                
                                        
                        
                            MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN LQKRLRRKD
                         
                        
                     
                    
                 | 
            
                                    
                | Function | 
                
                     Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.                  | 
            
            
            
             
             
                        
                | KEGG Pathway | 
                
                                    
                        
                                                                                    - Cytokine-cytokine receptor interaction (hsa04060 )
 
                                                                                    - PI3K-Akt sig.ling pathway (hsa04151 )
 
                                                                                    - Necroptosis (hsa04217 )
 
                                                                                    - Toll-like receptor sig.ling pathway (hsa04620 )
 
                                                                                    - NOD-like receptor sig.ling pathway (hsa04621 )
 
                                                                                    - RIG-I-like receptor sig.ling pathway (hsa04622 )
 
                                                                                    - Cytosolic D.-sensing pathway (hsa04623 )
 
                                                                                    - JAK-STAT sig.ling pathway (hsa04630 )
 
                                                                                    - .tural killer cell mediated cytotoxicity (hsa04650 )
 
                                                                                    - Alcoholic liver disease (hsa04936 )
 
                                                                                    - Tuberculosis (hsa05152 )
 
                                                                                    - Hepatitis C (hsa05160 )
 
                                                                                    - Hepatitis B (hsa05161 )
 
                                                                                    - Measles (hsa05162 )
 
                                                                                    - Human cytomegalovirus infection (hsa05163 )
 
                                                                                    - Influenza A (hsa05164 )
 
                                                                                    - Human papillomavirus infection (hsa05165 )
 
                                                                                    - Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
 
                                                                                    - Herpes simplex virus 1 infection (hsa05168 )
 
                                                                                    - Epstein-Barr virus infection (hsa05169 )
 
                                                                                    - Human immunodeficiency virus 1 infection (hsa05170 )
 
                                                                                    - Coro.virus disease - COVID-19 (hsa05171 )
 
                                                                                    - Pathways in cancer (hsa05200 )
 
                                                                                    - Autoimmune thyroid disease (hsa05320 )
 
                                                                                    - Lipid and atherosclerosis (hsa05417 )
 
                                                     
                        
                     
                                     | 
            
             
             
             
                        
                | Reactome Pathway | 
                
                                    
                        
                                                                                    - Regulation of IFNA/IFNB signaling (R-HSA-912694 )
 
                                                                                    - TRAF6 mediated IRF7 activation (R-HSA-933541 )
 
                                                                                    - SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
 
                                                                                    - Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
 
                                                                                    - Interferon alpha/beta signaling (R-HSA-909733 )
 
                                                     
                        
                     
                                     | 
            
             
             
            
                 | 
                 | 
                 | 
                 | 
                 | 
                 |