Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTILIOXF)

• DOT Name: MOB kinase activator 3A (MOB3A)
• Synonyms: MOB-LAK; Mob1 homolog 2A; Mps one binder kinase activator-like 2A
• Gene Name: MOB3A
• Related Disease: Mantle cell lymphoma
• UniProt ID: MOB3A_HUMAN
• Pfam ID: PF03637
• Sequence:
  MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDW
  VAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMD
  LLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSE
  AHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH
• Function: May regulate the activity of kinases.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Mantle cell lymphoma	DISFREOV	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of MOB kinase activator 3A (MOB3A).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of MOB kinase activator 3A (MOB3A).	[9]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of MOB kinase activator 3A (MOB3A).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of MOB kinase activator 3A (MOB3A).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of MOB kinase activator 3A (MOB3A).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of MOB kinase activator 3A (MOB3A).	[6]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of MOB kinase activator 3A (MOB3A).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of MOB kinase activator 3A (MOB3A).	[8]

References

• [1] Pathway discovery in mantle cell lymphoma by integrated analysis of high-resolution gene expression and copy number profiling.Blood. 2010 Aug 12;116(6):953-61. doi: 10.1182/blood-2010-01-263806. Epub 2010 Apr 26.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Bortezomib induces caspase-dependent apoptosis in Hodgkin lymphoma cell lines and is associated with reduced c-FLIP expression: a gene expression profiling study with implications for potential combination therapies. Leuk Res. 2008 Feb;32(2):275-85. doi: 10.1016/j.leukres.2007.05.024. Epub 2007 Jul 19.
• [8] Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
• [9] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.