Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIMGMOQ)

DOT Name Retinol-binding protein 5 (RBP5)
Synonyms Cellular retinol-binding protein III; CRBP-III; HRBPiso
Gene Name RBP5
UniProt ID
RET5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1GGL; 6E5W
Pfam ID
PF00061
Sequence
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRN
YTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLEL
TARDAVCEQVFRKVR
Function Intracellular transport of retinol.
Tissue Specificity
Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Retinol-binding protein 5 (RBP5). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Retinol-binding protein 5 (RBP5). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Retinol-binding protein 5 (RBP5). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Retinol-binding protein 5 (RBP5). [4]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Retinol-binding protein 5 (RBP5). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Retinol-binding protein 5 (RBP5). [2]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Retinol-binding protein 5 (RBP5). [6]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Retinol-binding protein 5 (RBP5). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
7 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.