Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ2GUB1)

DOT Name Vasopressin V2 receptor (AVPR2)
Synonyms V2R; AVPR V2; Antidiuretic hormone receptor; Renal-type arginine vasopressin receptor
Gene Name AVPR2
Related Disease
Diabetes insipidus, nephrogenic, X-linked ( )
Nephrogenic syndrome of inappropriate antidiuresis ( )
Nephrogenic diabetes insipidus ( )
UniProt ID
V2R_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4JQI; 6NI2; 6U1N; 7BB6; 7BB7; 7DF9; 7DFA; 7DFB; 7DFC; 7DW9; 7KH0; 7R0C; 7R0J; 8GOC; 8I10; 8JRU; 8JRV
Pfam ID
PF00001
Sequence
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Function Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.
Tissue Specificity Kidney.
KEGG Pathway
Phospholipase D sig.ling pathway (hsa04072 )
Neuroactive ligand-receptor interaction (hsa04080 )
Vasopressin-regulated water reabsorption (hsa04962 )
Reactome Pathway
G alpha (s) signalling events (R-HSA-418555 )
Vasopressin regulates renal water homeostasis via Aquaporins (R-HSA-432040 )
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )
Clathrin-mediated endocytosis (R-HSA-8856828 )
Defective AVP does not bind AVPR2 and causes neurohypophyseal diabetes insipidus (NDI) (R-HSA-9036092 )
Vasopressin-like receptors (R-HSA-388479 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Diabetes insipidus, nephrogenic, X-linked DISHUTO5 Definitive X-linked [1]
Nephrogenic syndrome of inappropriate antidiuresis DISRQBIJ Strong X-linked [2]
Nephrogenic diabetes insipidus DISKNSJK Supportive Autosomal dominant [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Regulation of Drug Effects of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
[3H]cAMP DMZRQU7 Investigative Vasopressin V2 receptor (AVPR2) increases the abundance of [3H]cAMP. [7]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Vasopressin V2 receptor (AVPR2). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Vasopressin V2 receptor (AVPR2). [6]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Vasopressin V2 receptor (AVPR2). [5]
------------------------------------------------------------------------------------

References

1 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2 Nephrogenic syndrome of inappropriate antidiuresis. N Engl J Med. 2005 May 5;352(18):1884-90. doi: 10.1056/NEJMoa042743.
3 Hereditary Nephrogenic Diabetes Insipidus. 2000 Feb 12 [updated 2020 Feb 27]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 In vitro effects of the endocrine disruptor p,p'DDT on human choriogonadotropin/luteinizing hormone receptor signalling. Arch Toxicol. 2021 May;95(5):1671-1681. doi: 10.1007/s00204-021-03007-1. Epub 2021 Feb 27.