Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJFZBX8)

• DOT Name: Alanine and arginine-rich domain-containing protein (AARD)
• Gene Name: AARD
• UniProt ID: AARD_HUMAN
• Sequence:
  MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLR
  RRLTRAFQWAVQRAISRRVQEAAAAAAAREEQSWTGVEATLARLRAELVEMHFQNHQLAR
  TLLDLNMKVQQLKKEYELEITSDSQSPKDDAANPE

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Alanine and arginine-rich domain-containing protein (AARD).	[1]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Alanine and arginine-rich domain-containing protein (AARD).	[2]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Alanine and arginine-rich domain-containing protein (AARD).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Alanine and arginine-rich domain-containing protein (AARD).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Alanine and arginine-rich domain-containing protein (AARD).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Alanine and arginine-rich domain-containing protein (AARD).	[4]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [3] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [6] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.