Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTJTMY5T)
| DOT Name | Peptidyl-prolyl cis-trans isomerase A-like 4A (PPIAL4A) | ||||
|---|---|---|---|---|---|
| Synonyms | PPIase A-like 4A; EC 5.2.1.8; Chromosome one-amplified sequence 2; COAS-2; Cyclophilin homolog overexpressed in liver cancer | ||||
| Gene Name | PPIAL4A | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence | 
                                         
                        MVNSVVFFDITVDGKPLGRISIKLFADKILKTAENFRALSTGEKGFRYKGSCFHRIIPGF 
                    
                MCQGGDFTRHNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTE WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF  | 
            ||||
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. | ||||
| Tissue Specificity | 
                                         
                        Highly expressed in brain, ovary and mammary gland. Moderately expressed in lung, salivary gland, kidney, skin, adipose tissue, intestine and spleen. Weakly expressed in skeletal muscle, liver and stomach. Expressed in pleiomorphic and undifferentiated liposarcomas, osteosarcomas and breast carcinomas.
                        
                     
                                     | 
            ||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     3 Drug(s) Affected the Gene/Protein Processing of This DOT 
                                                
  | 
            |||||||||||||||||||||||||||||||||||
| 
                     1 Drug(s) Affected the Post-Translational Modifications of This DOT 
                                                
  | 
            |||||||||||||||||||||||||||||||||||
References
