Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKLXS53)

DOT Name Sulfotransferase 1C4 (SULT1C4)
Synonyms ST1C4; EC 2.8.2.1; Sulfotransferase 1C2; SULT1C#2
Gene Name SULT1C4
UniProt ID
ST1C4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2AD1; 2GWH
EC Number
2.8.2.1
Pfam ID
PF00685
Sequence
MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTW
TQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHL
LPPSLLEKNCKIIYVARNPKDNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWH
EHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDKIVHYTSFDVMK
QNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQNERFDEDYKKKMTDTRLTFHF
QF
Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic compounds. Can also sulfonate estrogenic compounds, however, the dietary flavonoids (phytoestrogen) and environmental estrogens, like bisphenol A are better substrates than 17beta-estradiol (E2). Mediates the sulfation of doxorubicin and its analog epirubicin, two antitumor anthracyclines.
Tissue Specificity Expressed at high levels in fetal lung and kidney and at low levels in fetal heart, adult kidney, ovary and spinal chord.
Reactome Pathway
Paracetamol ADME (R-HSA-9753281 )
Cytosolic sulfonation of small molecules (R-HSA-156584 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Sulfotransferase 1C4 (SULT1C4). [1]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Sulfotransferase 1C4 (SULT1C4). [2]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Sulfotransferase 1C4 (SULT1C4). [3]
Permethrin DMZ0Q1G Approved Permethrin decreases the expression of Sulfotransferase 1C4 (SULT1C4). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Sulfotransferase 1C4 (SULT1C4). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Sulfotransferase 1C4 (SULT1C4). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Sulfotransferase 1C4 (SULT1C4). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
3 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
4 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
5 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
6 Involvement of the Endocrine-Disrupting Chemical Bisphenol A (BPA) in Human Placentation. J Clin Med. 2020 Feb 3;9(2):405. doi: 10.3390/jcm9020405.
7 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.