Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKOIR0G)

DOT Name Protein MFI (C11ORF65)
Synonyms Mitochondrial fission factor interactor
Gene Name C11ORF65
Related Disease
Cutaneous melanoma ( )
Hereditary neoplastic syndrome ( )
Ataxia-telangiectasia ( )
Uterine fibroids ( )
Hereditary breast ovarian cancer syndrome ( )
UniProt ID
MFI_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAE
LLDAAAGIHVRFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHL
QEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRK
IEWMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSVMEWEVDEVLNWTNTL
NFDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEP
NVTRLTPDSTYGL
Function Acts as an inhibitor of mitochondrial fission. Interacts with MFF and prevents DNM1L recruitment to mitochondria, promoting a more fused mitochondrial network.
Tissue Specificity Enriched in the pancreatic beta cell and the testis and is expressed at low levels in other tissues tested.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cutaneous melanoma DIS3MMH9 Definitive Genetic Variation [1]
Hereditary neoplastic syndrome DISGXLG5 Definitive CausalMutation [2]
Ataxia-telangiectasia DISP3EVR Strong CausalMutation [3]
Uterine fibroids DISBZRMJ Strong Genetic Variation [4]
Hereditary breast ovarian cancer syndrome DISWDUGU moderate Genetic Variation [5]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Protein MFI (C11ORF65). [6]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Protein MFI (C11ORF65). [7]
------------------------------------------------------------------------------------

References

1 Novel pleiotropic risk loci for melanoma and nevus density implicate multiple biological pathways.Nat Commun. 2018 Nov 14;9(1):4774. doi: 10.1038/s41467-018-06649-5.
2 Pathogenic Germline Variants in 10,389 Adult Cancers.Cell. 2018 Apr 5;173(2):355-370.e14. doi: 10.1016/j.cell.2018.03.039.
3 Association Between Inherited Germline Mutations in Cancer Predisposition Genes and Risk of Pancreatic Cancer.JAMA. 2018 Jun 19;319(23):2401-2409. doi: 10.1001/jama.2018.6228.
4 Genome-wide association and epidemiological analyses reveal common genetic origins between uterine leiomyomata and endometriosis.Nat Commun. 2019 Oct 24;10(1):4857. doi: 10.1038/s41467-019-12536-4.
5 Prioritizing Variants in Complete Hereditary Breast and Ovarian Cancer Genes in Patients Lacking Known BRCA Mutations.Hum Mutat. 2016 Jul;37(7):640-52. doi: 10.1002/humu.22972. Epub 2016 Mar 18.
6 Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
7 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.