Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTL4A57N)
| DOT Name | Osteocrin (OSTN) | ||||
|---|---|---|---|---|---|
| Synonyms | Musclin | ||||
| Gene Name | OSTN | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTA
KLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPM DRIGRNRLSNSRG |
||||
| Function |
Hormone that acts as a regulator of dendritic growth in the developing cerebral cortex in response to sensory experience. Induced in the brain following membrane depolarization and inhibits dendritic branching in neurons of the developing cortex. Probably acts by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production.
|
||||
| Tissue Specificity |
Enriched in neocortical regions of the developing cerebral cortex . Not expressed in other compartments of the neocortical wall or in brain regions such as the hippocampus, striatum, mediodorsal nucleus of the thalamus and cerebellum . Also expressed in bone . In developing neonatal rib bone, present at high level in osteoblasts on bone-forming surfaces, in newly incorporated osteocytes and in some late hypertrophic chondrocytes (at protein level) . In adult bone, localizes specifically to osteoblasts and young osteocytes at bone-forming sites (at protein level) .
|
||||
Molecular Interaction Atlas (MIA) of This DOT
|
6 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
