Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM2F25H)

DOT Name RNA-binding motif protein, Y chromosome, family 1 member A1 (RBMY1A1)
Synonyms RNA-binding motif protein 1; RNA-binding motif protein 2; Y chromosome RNA recognition motif 1; hRBMY
Gene Name RBMY1A1
Related Disease
Azoospermia ( )
Breast cancer ( )
Breast carcinoma ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Myelodysplastic syndrome ( )
Myelodysplastic/myeloproliferative neoplasm ( )
Neoplasm ( )
Oligospermia ( )
Retinoblastoma ( )
Von hippel-lindau disease ( )
Cryptorchidism ( )
Prader-Willi syndrome ( )
Thyroid gland carcinoma ( )
UniProt ID
RBY1A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2FY1
Pfam ID
PF08081 ; PF00076
Sequence
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY
Function
RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs.
Tissue Specificity Testis-specific.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Azoospermia DIS94181 Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [3]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [4]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [5]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [6]
Myelodysplastic/myeloproliferative neoplasm DISDHXQ4 Strong Genetic Variation [6]
Neoplasm DISZKGEW Strong Genetic Variation [7]
Oligospermia DIS6YJF3 Strong Biomarker [8]
Retinoblastoma DISVPNPB Strong Biomarker [9]
Von hippel-lindau disease DIS6ZFQQ Strong Genetic Variation [7]
Cryptorchidism DISYUD2P moderate Genetic Variation [10]
Prader-Willi syndrome DISYWMLU Limited Genetic Variation [10]
Thyroid gland carcinoma DISMNGZ0 Limited Genetic Variation [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Temozolomide DMKECZD Approved Temozolomide increases the expression of RNA-binding motif protein, Y chromosome, family 1 member A1 (RBMY1A1). [12]
------------------------------------------------------------------------------------

References

1 Deletion of RBM and DAZ in azoospermia: evaluation by PRINS.Am J Med Genet. 2002 Jan 15;107(2):105-8. doi: 10.1002/ajmg.10107.
2 Positive correlation between the expression of X-chromosome RBM genes (RBMX, RBM3, RBM10) and the proapoptotic Bax gene in human breast cancer.J Cell Biochem. 2006 Apr 15;97(6):1275-82. doi: 10.1002/jcb.20725.
3 mRNA expression of the putative antimetastatic gene BRMS1 and of apoptosis-related genes in breast cancer.Cancer Genomics Proteomics. 2011 Jul-Aug;8(4):195-7.
4 High expression of RBM8A predicts poor patient prognosis and promotes tumor progression in hepatocellular carcinoma.Oncol Rep. 2017 Apr;37(4):2167-2176. doi: 10.3892/or.2017.5457. Epub 2017 Feb 15.
5 A gene mutation in RNA-binding protein 10 is associated with lung adenocarcinoma progression and poor prognosis.Oncol Lett. 2018 Nov;16(5):6283-6292. doi: 10.3892/ol.2018.9496. Epub 2018 Sep 24.
6 "Bone marrow aspirate automated counts on hematology analyzers: formulating a scoring system based on hematology parameters, to discriminate reactive versus myelodysplastic syndrome-related bone marrows".Int J Lab Hematol. 2019 Aug;41(4):542-549. doi: 10.1111/ijlh.13049. Epub 2019 May 18.
7 Blockade of the vascular endothelial growth factor-receptor 2 pathway inhibits the growth of human renal cell carcinoma, RBM1-IT4, in the kidney but not in the bone of nude mice.Int J Oncol. 2007 Apr;30(4):937-45.
8 Y-chromosome microdeletion and phenotype in cytogenetically normal men with idiopathic azoospermia.Fertil Steril. 2001 Sep;76(3):491-5. doi: 10.1016/s0015-0282(01)01955-0.
9 Beta-lapachone inhibits proliferation and induces apoptosis in retinoblastoma cell lines.Eye (Lond). 2008 Mar;22(3):454-60. doi: 10.1038/sj.eye.6702764. Epub 2007 Mar 16.
10 Absence of microdeletions in the Y chromosome in patients with Prader-Willi syndrome with cryptorchidism.Int J Androl. 2002 Feb;25(1):1-5. doi: 10.1046/j.1365-2605.2002.00303.x.
11 Vemurafenib-resistance via de novo RBM genes mutations and chromosome 5 aberrations is overcome by combined therapy with palbociclib in thyroid carcinoma with BRAF(V600E).Oncotarget. 2017 Sep 24;8(49):84743-84760. doi: 10.18632/oncotarget.21262. eCollection 2017 Oct 17.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.