Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM3GWFP)

• DOT Name: Protein FAM3D (FAM3D)
• Gene Name: FAM3D
• Related Disease:
  Abdominal aortic aneurysm
  Colitis
  Metabolic disorder
  Non-insulin dependent diabetes
  Schizophrenia
  Acute myelogenous leukaemia
  Narcolepsy
• UniProt ID: FAM3D_HUMAN
• Pfam ID: PF15711
• Sequence:
  MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKP
  CPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFD
  MYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWV
  FIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF
• Tissue Specificity: Abundantly expressed in placenta and weakly expressed in small intestine.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[1]
Colitis	DISAF7DD	Strong	Altered Expression	[2]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[3]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[3]
Schizophrenia	DISSRV2N	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[5]
Narcolepsy	DISLCNLI	moderate	Genetic Variation	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein FAM3D (FAM3D).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein FAM3D (FAM3D).	[8]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein FAM3D (FAM3D).	[9]

References

• [1] Deficiency of FAM3D (Family With Sequence Similarity 3, Member D), A Novel Chemokine, Attenuates Neutrophil Recruitment and Ameliorates Abdominal Aortic Aneurysm Development.Arterioscler Thromb Vasc Biol. 2018 Jul;38(7):1616-1631. doi: 10.1161/ATVBAHA.118.311289. Epub 2018 May 31.
• [2] Identification of FAM3D as a new endogenous chemotaxis agonist for the formyl peptide receptors.J Cell Sci. 2016 May 1;129(9):1831-42. doi: 10.1242/jcs.183053. Epub 2016 Mar 10.
• [3] FAM3D inhibits glucagon secretion via MKP1-dependent suppression of ERK1/2 signaling.Cell Biol Toxicol. 2017 Oct;33(5):457-466. doi: 10.1007/s10565-017-9387-8. Epub 2017 Feb 28.
• [4] Exome sequencing supports a de novo mutational paradigm for schizophrenia.Nat Genet. 2011 Aug 7;43(9):864-8. doi: 10.1038/ng.902.
• [5] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [6] An approach based on a genome-wide association study reveals candidate loci for narcolepsy.Hum Genet. 2010 Oct;128(4):433-41. doi: 10.1007/s00439-010-0862-z. Epub 2010 Jul 31.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.