Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMEJ7M1)

DOT Name CXXC motif containing zinc binding protein (CZIB)
Synonyms UPF0587 protein C1orf123
Gene Name CZIB
UniProt ID
CZIB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5ZLQ; 5ZRT
Pfam ID
PF05907
Sequence
MGKIALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGS
ASMVQKCKLCARENSIEILSSTIKPYNAEDNENFKTIVEFECRGLEPVDFQPQAGFAAEG
VESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of CXXC motif containing zinc binding protein (CZIB). [1]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of CXXC motif containing zinc binding protein (CZIB). [2]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of CXXC motif containing zinc binding protein (CZIB). [3]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of CXXC motif containing zinc binding protein (CZIB). [4]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of CXXC motif containing zinc binding protein (CZIB). [5]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of CXXC motif containing zinc binding protein (CZIB). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of CXXC motif containing zinc binding protein (CZIB). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
5 Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
6 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
7 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.