General Information of Drug Off-Target (DOT) (ID: OTMHZ1WP)

DOT Name Vesicle-associated membrane protein 1
Synonyms VAMP-1; Synaptobrevin-1
Gene Name VAMP1
Related Disease
Myasthenic syndrome, congenital, 25, presynaptic ( )
Spastic ataxia 1 ( )
Obsolete presynaptic congenital myasthenic syndrome ( )
UniProt ID
VAMP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00957
Sequence
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Tissue Specificity Nervous system, skeletal muscle and adipose tissue.
KEGG Pathway
S.RE interactions in vesicular transport (hsa04130 )
Reactome Pathway
Toxicity of botulinum toxin type F (botF) (R-HSA-5250981 )
Toxicity of botulinum toxin type G (botG) (R-HSA-5250989 )
Toxicity of botulinum toxin type D (botD) (R-HSA-5250955 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Myasthenic syndrome, congenital, 25, presynaptic DIS3TY1U Strong Autosomal recessive [1]
Spastic ataxia 1 DISUKK0J Strong Autosomal dominant [2]
Obsolete presynaptic congenital myasthenic syndrome DISCATK3 Supportive Autosomal dominant [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Vesicle-associated membrane protein 1. [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Vesicle-associated membrane protein 1. [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Vesicle-associated membrane protein 1. [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Vesicle-associated membrane protein 1. [7]
Aspirin DM672AH Approved Aspirin decreases the expression of Vesicle-associated membrane protein 1. [8]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Vesicle-associated membrane protein 1. [9]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Vesicle-associated membrane protein 1. [11]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Vesicle-associated membrane protein 1. [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Vesicle-associated membrane protein 1. [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Vesicle-associated membrane protein 1. [10]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Vesicle-associated membrane protein 1. [14]
------------------------------------------------------------------------------------

References

1 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
2 VAMP1 mutation causes dominant hereditary spastic ataxia in Newfoundland families. Am J Hum Genet. 2012 Sep 7;91(3):548-52. doi: 10.1016/j.ajhg.2012.07.018.
3 Homozygous mutations in VAMP1 cause a presynaptic congenital myasthenic syndrome. Ann Neurol. 2017 Apr;81(4):597-603. doi: 10.1002/ana.24905. Epub 2017 Mar 29.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
7 Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
8 Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
12 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
13 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.