Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMM6ANB)

• DOT Name: Sperm protein associated with the nucleus on the X chromosome D (SPANXD)
• Synonyms: Cancer/testis antigen 11.4; CT11.4; Nuclear-associated protein SPAN-Xd; SPANX-D; SPANX family member D
• Gene Name: SPANXD
• Related Disease:
  Melanoma
  Uveal Melanoma
• UniProt ID: SPNXD_HUMAN
• Pfam ID: PF07458
• Sequence:
  MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNFK
  RTSPEELVNDHARKNRINPLQMEEEEFMEIMVEIPAK
• Tissue Specificity: Detected in testis, sperm and a melanoma cell line.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Strong	Biomarker	[1]
Uveal Melanoma	DISA7ZGL	Strong	Altered Expression	[2]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sperm protein associated with the nucleus on the X chromosome D (SPANXD).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Sperm protein associated with the nucleus on the X chromosome D (SPANXD).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Sperm protein associated with the nucleus on the X chromosome D (SPANXD).	[5]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Sperm protein associated with the nucleus on the X chromosome D (SPANXD).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Sperm protein associated with the nucleus on the X chromosome D (SPANXD).	[7]
Maleic Acid	DM4L0R7	Investigative	Maleic Acid increases the expression of Sperm protein associated with the nucleus on the X chromosome D (SPANXD).	[8]

References

• [1] SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Sicilian patients with melanoma.Melanoma Res. 2008 Aug;18(4):295-9. doi: 10.1097/CMR.0b013e32830aaa90.
• [2] Immunoexpression of SPANX-C in metastatic uveal melanoma.Pathol Res Pract. 2019 Jul;215(7):152431. doi: 10.1016/j.prp.2019.04.023. Epub 2019 Apr 29.
• [3] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
• [6] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] Profiling transcriptomes of human SH-SY5Y neuroblastoma cells exposed to maleic acid. PeerJ. 2017 Apr 5;5:e3175.