Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMMY5OE)

• DOT Name: Piercer of microtubule wall 2 protein (PIERCE2)
• Gene Name: PIERCE2
• UniProt ID: PIRC2_HUMAN
• PDB ID: 7UNG; 8J07
• Pfam ID: PF14892
• Sequence:
  MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYK
  TNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHT
  L
• Function: Microtubule inner protein involved in the attachment of outer dynein arms (ODAs) to dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
• Tissue Specificity: Expressed in airway epithelial cells.

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Piercer of microtubule wall 2 protein (PIERCE2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Piercer of microtubule wall 2 protein (PIERCE2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Piercer of microtubule wall 2 protein (PIERCE2).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Piercer of microtubule wall 2 protein (PIERCE2).	[4]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.