Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN7IISS)

DOT Name Small ribosomal subunit protein mS25 (MRPS25)
Synonyms 28S ribosomal protein S25, mitochondrial; MRP-S25; S25mt
Gene Name MRPS25
Related Disease
Combined oxidative phosphorylation deficiency 50 ( )
Mitochondrial encephalomyopathy ( )
UniProt ID
RT25_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3J9M ; 6NU2 ; 6NU3 ; 6RW4 ; 6RW5 ; 6VLZ ; 6VMI ; 6ZM5 ; 6ZM6 ; 6ZS9 ; 6ZSA ; 6ZSB ; 6ZSC ; 6ZSD ; 6ZSE ; 6ZSG ; 7A5F ; 7A5G ; 7A5I ; 7A5K ; 7L08 ; 7OG4 ; 7P2E ; 7PNX ; 7PNY ; 7PNZ ; 7PO0 ; 7PO1 ; 7PO2 ; 7PO3 ; 7QI4 ; 7QI5 ; 7QI6 ; 8ANY ; 8CSP ; 8CSQ ; 8CSR ; 8CSS ; 8CST ; 8CSU ; 8OIR ; 8OIS
Pfam ID
PF05047
Sequence
MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNP
WVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEK
KQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
Reactome Pathway
Mitochondrial translation elongation (R-HSA-5389840 )
Mitochondrial translation termination (R-HSA-5419276 )
Mitochondrial translation initiation (R-HSA-5368286 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Combined oxidative phosphorylation deficiency 50 DISG3QXJ Limited Unknown [1]
Mitochondrial encephalomyopathy DISA6PTN Limited Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Small ribosomal subunit protein mS25 (MRPS25). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Small ribosomal subunit protein mS25 (MRPS25). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Small ribosomal subunit protein mS25 (MRPS25). [4]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Small ribosomal subunit protein mS25 (MRPS25). [5]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Small ribosomal subunit protein mS25 (MRPS25). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Small ribosomal subunit protein mS25 (MRPS25). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 MRPS25 mutations impair mitochondrial translation and cause encephalomyopathy. Hum Mol Genet. 2019 Aug 15;28(16):2711-2719. doi: 10.1093/hmg/ddz093.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
7 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.