Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNEEWRN)

DOT Name Ciliary neurotrophic factor (CNTF)
Synonyms CNTF
Gene Name CNTF
UniProt ID
CNTF_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1CNT; 8D74
Pfam ID
PF01110
Sequence
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
SHQTGIPARGSHYIANNKKM
Function CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Tissue Specificity Nervous system.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
JAK-STAT sig.ling pathway (hsa04630 )
Reactome Pathway
IL-6-type cytokine receptor ligand interactions (R-HSA-6788467 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the activity of Ciliary neurotrophic factor (CNTF). [1]
Marinol DM70IK5 Approved Marinol increases the expression of Ciliary neurotrophic factor (CNTF). [2]
Testosterone Undecanoate DMZO10Y Approved Testosterone Undecanoate increases the expression of Ciliary neurotrophic factor (CNTF). [3]
Nitrous oxide DMTHWBI Approved Nitrous oxide decreases the activity of Ciliary neurotrophic factor (CNTF). [1]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Ciliary neurotrophic factor (CNTF). [4]
------------------------------------------------------------------------------------

References

1 Inducers of oxidative stress block ciliary neurotrophic factor activation of Jak/STAT signaling in neurons. J Neurochem. 2005 Mar;92(6):1521-30. doi: 10.1111/j.1471-4159.2004.02990.x.
2 Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
3 Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
4 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.